- ZNF502 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82298
- PBS (pH 7.2) and 40% Glycerol
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: FQEGGFGRIT FIHKEAPPEI ISQGYNFEKS LLLTSSLVTR LRVSTEESLH QWETSNIQTN DISDQSKCPT LCTQ
- ZNF502
- Unconjugated
- zinc finger protein 502
- Human (Hu)
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- 0.1 ml (also 25ul)
- Immunogen affinity purified
Sequence
FQEGGFGRITFIHKEAPPEIISQGYNFEKSLLLTSSLVTRLRVSTEESLHQWETSNIQTNDISDQSKCPTLCTQ
Specifications/Features
Available conjugates: Unconjugated